X
Search Filters
Format Format
Subjects Subjects
Subjects Subjects
X
Sort by Item Count (A-Z)
Filter by Count
index medicus (15) 15
humans (12) 12
cell biology (10) 10
oxidative stress (9) 9
analysis (8) 8
skin (8) 8
animals (7) 7
air pollution (5) 5
biophysics (5) 5
gene expression (5) 5
patch clamp (5) 5
patch-clamp techniques (5) 5
physiology (5) 5
activation (4) 4
antioxidants (4) 4
enzymes (4) 4
immunohistochemistry (4) 4
kinetics (4) 4
nb4 (4) 4
acute promyelocytic leukemia (3) 3
atra (3) 3
biochemistry & molecular biology (3) 3
biotechnology (3) 3
care and treatment (3) 3
cell line (3) 3
cell line, tumor (3) 3
cell movement - physiology (3) 3
environmental aspects (3) 3
female (3) 3
hydrogen peroxide (3) 3
ion channels (3) 3
keratinocytes - metabolism (3) 3
life sciences (3) 3
neurosciences (3) 3
oxidative damage (3) 3
ozone (3) 3
patch-clamp (3) 3
phospholipase c beta (3) 3
photoreceptors (3) 3
physiological aspects (3) 3
pollution (3) 3
pressure (3) 3
a549 cells (2) 2
acid (2) 2
acids (2) 2
actin (2) 2
amino acid sequence (2) 2
antimicrobial peptides (2) 2
apl-derived cell (2) 2
apoptosis (2) 2
autism (2) 2
breast neoplasms - pathology (2) 2
calcium (2) 2
catalase (2) 2
cell culture (2) 2
cell differentiation (2) 2
cell differentiation - drug effects (2) 2
cell membrane - drug effects (2) 2
cell membrane - metabolism (2) 2
chemistry, medicinal (2) 2
chloride channels (2) 2
chloride currents (2) 2
cytotoxicity (2) 2
electrophysiology (2) 2
endocannabinoid system (2) 2
environmental stressors (2) 2
epithelial cells - drug effects (2) 2
epithelial cells - metabolism (2) 2
exchanger (2) 2
exposure (2) 2
expression (2) 2
fatty acid amide hydrolase (2) 2
free-radicals (2) 2
genetic research (2) 2
geriatrics & gerontology (2) 2
glass - chemistry (2) 2
hl-60 cells (2) 2
inflammation (2) 2
inhibitors (2) 2
isoenzymes - biosynthesis (2) 2
isoenzymes - genetics (2) 2
keratinocytes - pathology (2) 2
lipids (2) 2
mechanism (2) 2
medical research (2) 2
medicine (2) 2
medicine, experimental (2) 2
melanoma (2) 2
membranes, artificial (2) 2
migration (2) 2
molecular biology (2) 2
nervous system diseases (2) 2
neurogenesis (2) 2
neurons (2) 2
nf-e2-related factor 2 - metabolism (2) 2
nf-kappa-b (2) 2
olfactory bulb (2) 2
olfactory bulb - physiology (2) 2
organic chemistry (2) 2
patch-clamp techniques - instrumentation (2) 2
more...
Language Language
Publication Date Publication Date
Click on a bar to filter by decade
Slide to change publication date range


Journal of Cellular Physiology, ISSN 0021-9541, 08/2018, Volume 233, Issue 8, pp. 6018 - 6027
The lung tissue is one of the main targets of oxidative stress due to external sources and respiratory activity. In our previous work, we have demonstrated in... 
patch clamp | redox imbalance | catalase | chloride current | ozone | respiratory tract | RESVERATROL | ACTIVATION | PHYSIOLOGY | AMBIENT LEVELS | CELL BIOLOGY | EPITHELIAL-CELLS | CHANNEL | SIGNALING PATHWAY | HYDROGEN-PEROXIDE | NF-KAPPA-B | EXPOSURE | Prevention | Oxidative stress | Analysis | Glucose oxidase | Hydrogen peroxide | Epithelial cells | Byproducts | Activation | Exposure | Chloride currents | Chloride | Catalase | Lungs | Rectifiers | Resveratrol | Chloride channels
Journal Article
Journal of Cellular Physiology, ISSN 0021-9541, 10/2019, Volume 234, Issue 10, pp. 17704 - 17713
K+ channels of the alveolar epithelium control the driving force acting on the ionic and solvent flow through the cell membrane contributing to the maintenance... 
K+ channels | 9‐AC | A549 cells | ANO‐6 | DCPIB | pneumocytes | ACTIVATION | PHYSIOLOGY | ACID | POTASSIUM CHANNELS | VOLUME | 9-AC | CELL BIOLOGY | ANO-6 | AIRWAY | ROLES | K plus channels | I-CL,I-SWELL | K+ CHANNELS | MODULATION | Cell membranes | Pharmacology | Chloride currents | Epithelium | Butyric acid | Resistance | Pneumocytes | Inhibitors | Acids | Modulation | Functional testing | Rectifiers | Chloride channels | Conductance | Membrane potential | Cell size | Alveoli | Alternating current | Constitution
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 07/2017, Volume 108, p. S59
Ozone (O.sub.3) is among the most toxic stressors to which living organisms are continuously exposed and the skin is one of the most susceptible tissues to... 
Antioxidants | Physiological aspects | Environmental aspects | Pollution | Skin
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 07/2017, Volume 108, pp. S59 - S59
Journal Article
Journal of Cellular Physiology, ISSN 0021-9541, 10/2019, Volume 234, Issue 10, pp. 17704 - 17713
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 11/2018, Volume 128, pp. S108 - S109
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 05/2018, Volume 120, p. S57
To access, purchase, authenticate, or subscribe to the full-text of this article, please visit this link: http://dx.doi.org/10.1016/j.freeradbiomed.2018.04.189 
Environmental aspects | Air pollution
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 05/2018, Volume 120, pp. S57 - S57
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 05/2018, Volume 120, p. S156
To access, purchase, authenticate, or subscribe to the full-text of this article, please visit this link: http://dx.doi.org/10.1016/j.freeradbiomed.2018.04.515 
Medicine, Experimental | Enzymes | Medical research | RNA | Analysis | Rett syndrome
Journal Article
Molecules, ISSN 1420-3049, 2014, Volume 19, Issue 7, pp. 9228 - 9239
The membrane-destabilization properties of the recently-introduced endosomolytic CM18-Tat11 hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1-7 of... 
CPP | Carpet | Toroidal-pore | AMP | Patch-clamp | Chimera | Cell-Penetrating Peptides - pharmacology | Cricetinae | Patch-Clamp Techniques | Animals | Cricetulus | Membrane Potentials | Recombinant Fusion Proteins - pharmacology | Cell Membrane Permeability | CHO Cells | chimera | toroidal-pore | patch-clamp | carpet
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 07/2017, Volume 108, pp. S50 - S50
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 07/2017, Volume 108, p. S65
The Autistic Spectrum Disorder (ASD) refers to a range of conditions classified as neurodevelopmental disorders characteristic of the early childhood. 
Autism | Enzymes | Biological products | Analysis | Cardiac patients | Quality control | Genetic research | Electron microscopy | Quality management
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 07/2017, Volume 108, p. S45
In this work we have investigated the effects of ozone (O.sub.3), one of the most noxious pollutants to which respiratory tract is organ most exposed, on Cl... 
Oxidases | Oxidative stress | Biotechnology | Air pollution | Gene expression | Hydrogen peroxide
Journal Article
Free Radical Biology and Medicine, ISSN 0891-5849, 07/2017, Volume 108, pp. S63 - S63
Journal Article
No results were found for your search.

Cannot display more than 1000 results, please narrow the terms of your search.